PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peaxi162Scf00684g00572.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia
Family G2-like
Protein Properties Length: 380aa    MW: 42564.1 Da    PI: 8.6807
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peaxi162Scf00684g00572.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like102.72.3e-32242297156
                   G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                               k+r++W++eLH+rF++a++qLGGs+ AtPk+i+elm+v+gLt+++vkSHLQkYRl+
  Peaxi162Scf00684g00572.1 242 KQRRCWSQELHRRFIDALQQLGGSQAATPKQIRELMQVDGLTNDEVKSHLQKYRLH 297
                               79****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.165239299IPR017930Myb domain
SuperFamilySSF466893.49E-18239300IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.605.5E-29240300IPR009057Homeodomain-like
TIGRFAMsTIGR015571.0E-26242297IPR006447Myb domain, plants
PfamPF002497.0E-8244295IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 380 aa     Download sequence    Send to blast
MGSIDPPEVS LDCKTKTYIP KTITQFLEEV SMIRNVTEKM LKIEHYLMVI VAVIAALRAE  60
SMQYKKSIVE PILEEFMPLK KSSREDDKLE GNKDKDSREK MNWMSSVQLW NSDPHSPNAD  120
MVNNKQSSKL ELKKSSPRGG DETVLYGPFQ SSKARSVGKA FAPFKGCSGF PAKVVRKEDK  180
DELHRVPGLS LCTPGIKNLE NTMISGLSSK PSDNSGSFSI IASSKSNIRT GSQLQQQQTA  240
RKQRRCWSQE LHRRFIDALQ QLGGSQAATP KQIRELMQVD GLTNDEVKSH LQKYRLHIRK  300
VPNTSTNEAG LLGNLWMPQD KYGESSKHSS SQSGSPQCPF QLEGSSRGTS MTGEDSMEEE  360
DDEKFESHSW KVQKSGENDV
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009782556.11e-157PREDICTED: uncharacterized protein LOC104231288
TrEMBLA0A0V0I6V01e-145A0A0V0I6V0_SOLCH; Putative two-component response regulator-like APRR2-like
STRINGSolyc01g108300.2.11e-145(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA43612443
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G03500.14e-35G2-like family protein